Lineage for d3b3xb_ (3b3x B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1054946Species Bacillus licheniformis [TaxId:1402] [188244] (4 PDB entries)
  8. 1054954Domain d3b3xb_: 3b3x B: [172423]
    automated match to d1i2wb_
    complexed with a33

Details for d3b3xb_

PDB Entry: 3b3x (more details), 2.5 Å

PDB Description: Crystal structure of class A beta-lactamase of Bacillus licheniformis BS3 with aminocitrate
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3b3xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b3xb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvvkal

SCOPe Domain Coordinates for d3b3xb_:

Click to download the PDB-style file with coordinates for d3b3xb_.
(The format of our PDB-style files is described here.)

Timeline for d3b3xb_: