Lineage for d3b07e_ (3b07 E:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022603Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 3022604Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 3022605Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 3022688Protein automated matches [190904] (4 species)
    not a true protein
  7. 3022691Species Staphylococcus aureus [TaxId:158878] [189747] (5 PDB entries)
  8. 3022700Domain d3b07e_: 3b07 E: [172397]
    automated match to d1lkfa_
    complexed with mpd

Details for d3b07e_

PDB Entry: 3b07 (more details), 2.5 Å

PDB Description: Crystal structure of octameric pore form of gamma-hemolysin from Staphylococcus aureus
PDB Compounds: (E:) Gamma-hemolysin component B

SCOPe Domain Sequences for d3b07e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b07e_ f.6.1.1 (E:) automated matches {Staphylococcus aureus [TaxId: 158878]}
vtlykttatadsdkfkisqiltfnfikdksydkdtlvlkatgninsgfvkpnpndydfsk
lywgakynvsissqsndsvnvvdyapknqneefqvqntlgytfggdisisnglsgglngn
tafsetinykqesyrttlsrntnyknvgwgveahkimnngwgpygrdsfhptygnelfla
grqssayagqnfiaqhqmpllsrsnfnpeflsvlshrqdgakkskitvtyqremdlyqic
wngfywaganyknfktrtfkstyeidwenhkvklldtketennk

SCOPe Domain Coordinates for d3b07e_:

Click to download the PDB-style file with coordinates for d3b07e_.
(The format of our PDB-style files is described here.)

Timeline for d3b07e_: