| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) ![]() |
| Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit automatically mapped to Pfam PF07968 |
| Protein automated matches [190904] (4 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158878] [189747] (5 PDB entries) |
| Domain d3b07e_: 3b07 E: [172397] automated match to d1lkfa_ complexed with mpd |
PDB Entry: 3b07 (more details), 2.5 Å
SCOPe Domain Sequences for d3b07e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b07e_ f.6.1.1 (E:) automated matches {Staphylococcus aureus [TaxId: 158878]}
vtlykttatadsdkfkisqiltfnfikdksydkdtlvlkatgninsgfvkpnpndydfsk
lywgakynvsissqsndsvnvvdyapknqneefqvqntlgytfggdisisnglsgglngn
tafsetinykqesyrttlsrntnyknvgwgveahkimnngwgpygrdsfhptygnelfla
grqssayagqnfiaqhqmpllsrsnfnpeflsvlshrqdgakkskitvtyqremdlyqic
wngfywaganyknfktrtfkstyeidwenhkvklldtketennk
Timeline for d3b07e_: