Lineage for d3b07d_ (3b07 D:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237059Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 1237060Superfamily f.6.1: Leukocidin-like [56959] (2 families) (S)
  5. 1237061Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
  6. 1237117Protein automated matches [190904] (2 species)
    not a true protein
  7. 1237118Species Staphylococcus aureus [TaxId:158878] [189747] (2 PDB entries)
  8. 1237148Domain d3b07d_: 3b07 D: [172396]
    automated match to d1t5ra_
    complexed with mpd

Details for d3b07d_

PDB Entry: 3b07 (more details), 2.5 Å

PDB Description: Crystal structure of octameric pore form of gamma-hemolysin from Staphylococcus aureus
PDB Compounds: (D:) Gamma-hemolysin component A

SCOPe Domain Sequences for d3b07d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b07d_ f.6.1.1 (D:) automated matches {Staphylococcus aureus [TaxId: 158878]}
aeiikrtqditskrlaitqniqfdfvkdkkynkdalvvkmqgfissrttysdlkkypyik
rmiwpfqynislktkdsnvdlinylpknkidsadvsqklgyniggnfqsapsiggsgsfn
ysktisynqknyvtevesqnskgvkwgvkansfvtpngqvsaydqylfaqdptgpaardy
fvpdnqlppliqsgfnpsfittlshergkgdksefeitygrnmdatyayvtrhrlavdrk
hdafknrnvtvkyevnwkthevkiksitpk

SCOPe Domain Coordinates for d3b07d_:

Click to download the PDB-style file with coordinates for d3b07d_.
(The format of our PDB-style files is described here.)

Timeline for d3b07d_: