![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
![]() | Superfamily f.6.1: Leukocidin-like [56959] (2 families) ![]() |
![]() | Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit |
![]() | Protein automated matches [190904] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [189747] (2 PDB entries) |
![]() | Domain d3b07c_: 3b07 C: [172395] automated match to d1lkfa_ complexed with mpd |
PDB Entry: 3b07 (more details), 2.5 Å
SCOPe Domain Sequences for d3b07c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b07c_ f.6.1.1 (C:) automated matches {Staphylococcus aureus [TaxId: 158878]} vtlykttatadsdkfkisqiltfnfikdksydkdtlvlkatgninsgfvkpnpndydfsk lywgakynvsissqsndsvnvvdyapknqneefqvqntlgytfggdisisnglsgglngn tafsetinykqesyrttlsrntnyknvgwgveahkimnngwgpygrdsfhptygnelfla grqssayagqnfiaqhqmpllsrsnfnpeflsvlshrqdgakkskitvtyqremdlyqic wngfywaganyknfktrtfkstyeidwenhkvklldtketennk
Timeline for d3b07c_: