Lineage for d3b07a_ (3b07 A:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058516Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 1058517Superfamily f.6.1: Leukocidin-like [56959] (2 families) (S)
  5. 1058518Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
  6. 1058574Protein automated matches [190904] (2 species)
    not a true protein
  7. 1058575Species Staphylococcus aureus [TaxId:158878] [189747] (2 PDB entries)
  8. 1058602Domain d3b07a_: 3b07 A: [172393]
    automated match to d1lkfa_
    complexed with mpd

Details for d3b07a_

PDB Entry: 3b07 (more details), 2.5 Å

PDB Description: Crystal structure of octameric pore form of gamma-hemolysin from Staphylococcus aureus
PDB Compounds: (A:) Gamma-hemolysin component B

SCOPe Domain Sequences for d3b07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b07a_ f.6.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
vtlykttatadsdkfkisqiltfnfikdksydkdtlvlkatgninsgfvkpnpndydfsk
lywgakynvsissqsndsvnvvdyapknqneefqvqntlgytfggdisisnglsgglngn
tafsetinykqesyrttlsrntnyknvgwgveahkimnngwgpygrdsfhptygnelfla
grqssayagqnfiaqhqmpllsrsnfnpeflsvlshrqdgakkskitvtyqremdlyqic
wngfywaganyknfktrtfkstyeidwenhkvklldtketennk

SCOPe Domain Coordinates for d3b07a_:

Click to download the PDB-style file with coordinates for d3b07a_.
(The format of our PDB-style files is described here.)

Timeline for d3b07a_: