Lineage for d3axyj_ (3axy J:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745953Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 1745954Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 1746000Protein automated matches [190238] (5 species)
    not a true protein
  7. 1746060Species Oryza sativa [TaxId:39947] [189745] (1 PDB entry)
  8. 1746064Domain d3axyj_: 3axy J: [172376]
    automated match to d1o9ca_
    protein/DNA complex

Details for d3axyj_

PDB Entry: 3axy (more details), 2.4 Å

PDB Description: Structure of Florigen Activation Complex Consisting of Rice Florigen Hd3a, 14-3-3 Protein GF14 and Rice FD Homolog OsFD1
PDB Compounds: (J:) 14-3-3-like protein GF14-C

SCOPe Domain Sequences for d3axyj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3axyj_ a.118.7.1 (J:) automated matches {Oryza sativa [TaxId: 39947]}
sreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarrasw
rivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskvf
ylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsvf
yyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd

SCOPe Domain Coordinates for d3axyj_:

Click to download the PDB-style file with coordinates for d3axyj_.
(The format of our PDB-style files is described here.)

Timeline for d3axyj_: