Lineage for d1tnxa_ (1tnx A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 769066Protein Troponin C [47503] (6 species)
  7. 769067Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 769088Domain d1tnxa_: 1tnx A: [17237]
    mutant

Details for d1tnxa_

PDB Entry: 1tnx (more details)

PDB Description: nmr solution structure of calcium saturated skeletal muscle troponin c
PDB Compounds: (A:) troponin c

SCOP Domain Sequences for d1tnxa_:

Sequence, based on SEQRES records: (download)

>d1tnxa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
dqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilra
tgehvieediedlmkdsdknndgridfdeflkmm

Sequence, based on observed residues (ATOM records): (download)

>d1tnxa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
dqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiiee
vdedgsgtidfeeflvmmvrqeeelancfrifdknadgfidieelgeilratgehvieed
iedlmkdsdknndgridfdeflkmm

SCOP Domain Coordinates for d1tnxa_:

Click to download the PDB-style file with coordinates for d1tnxa_.
(The format of our PDB-style files is described here.)

Timeline for d1tnxa_: