SCOP 1.73: Domain d1tnxa_: 1tnx A:

Lineage for d1tnxa_ (1tnx A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)

8. Domain d1tnxa_: 1tnx A: [17237]
   mutant

Details for d1tnxa_

PDB Entry: 1tnx

PDB Description: nmr solution structure of calcium saturated skeletal muscle troponin c

PDB Compounds: (A:) troponin c

SCOP Domain Sequences for d1tnxa_:

Sequence, based on SEQRES records:

>d1tnxa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
dqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilra
tgehvieediedlmkdsdknndgridfdeflkmm

Sequence, based on observed residues (ATOM records):

>d1tnxa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
dqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiiee
vdedgsgtidfeeflvmmvrqeeelancfrifdknadgfidieelgeilratgehvieed
iedlmkdsdknndgridfdeflkmm

Timeline for d1tnxa_:

• d1tnxa_ first appeared (with stable ids) in SCOP 1.55, called d1tnx__
  
• d1tnxa_ was called d1tnx__ in SCOP 1.71
  
• d1tnxa_ appears in SCOP 1.75
  
• d1tnxa_ appears in the current release, SCOPe 2.08