SCOP 1.71: Domain d1tnx__: 1tnx -

Lineage for d1tnx__ (1tnx -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (26 PDB entries)

8. Domain d1tnx__: 1tnx - [17237]
   mutant

Details for d1tnx__

PDB Entry: 1tnx

PDB Description: nmr solution structure of calcium saturated skeletal muscle troponin c

SCOP Domain Sequences for d1tnx__:

Sequence, based on SEQRES records:

>d1tnx__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
dqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilra
tgehvieediedlmkdsdknndgridfdeflkmm

Sequence, based on observed residues (ATOM records):

>d1tnx__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
dqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiiee
vdedgsgtidfeeflvmmvrqeeelancfrifdknadgfidieelgeilratgehvieed
iedlmkdsdknndgridfdeflkmm

Timeline for d1tnx__:

• d1tnx__ first appeared (with stable ids) in SCOP 1.55
  
• d1tnx__ appears in SCOP 1.69
  
• d1tnx__ is called d1tnxa_ in SCOP 1.73
  
• d1tnx__ appears in the current release, SCOPe 2.08, called d1tnxa_