Lineage for d1dtla_ (1dtl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324288Protein Troponin C [47503] (6 species)
  7. 2324289Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 2324297Domain d1dtla_: 1dtl A: [17229]
    complexed with bep, ca

Details for d1dtla_

PDB Entry: 1dtl (more details), 2.15 Å

PDB Description: crystal structure of calcium-saturated (3ca2+) cardiac troponin c complexed with the calcium sensitizer bepridil at 2.15 a resolution
PDB Compounds: (A:) cardiac troponin c

SCOPe Domain Sequences for d1dtla_:

Sequence, based on SEQRES records: (download)

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
ykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemidev
dedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkimlqat
getiteddieelmkdgdknndgridydeflefmkgv

Sequence, based on observed residues (ATOM records): (download)

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
ykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemidev
dedgsgtvdfdeflvmmvrsmkkseeelsdlfrmfdknadgyidleelkimlqattited
dieelmkdgdknndgridydeflefmkgv

SCOPe Domain Coordinates for d1dtla_:

Click to download the PDB-style file with coordinates for d1dtla_.
(The format of our PDB-style files is described here.)

Timeline for d1dtla_: