Lineage for d1dtla_ (1dtl A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3402Protein Troponin C [47503] (5 species)
  7. 3403Species Chicken (Gallus gallus) [TaxId:9031] [47504] (21 PDB entries)
  8. 3411Domain d1dtla_: 1dtl A: [17229]

Details for d1dtla_

PDB Entry: 1dtl (more details), 2.15 Å

PDB Description: crystal structure of calcium-saturated (3ca2+) cardiac troponin c complexed with the calcium sensitizer bepridil at 2.15 a resolution

SCOP Domain Sequences for d1dtla_:

Sequence, based on SEQRES records: (download)

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)}
ykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemidev
dedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkimlqat
getiteddieelmkdgdknndgridydeflefmkgv

Sequence, based on observed residues (ATOM records): (download)

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)}
ykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemidev
dedgsgtvdfdeflvmmvrsmkkseeelsdlfrmfdknadgyidleelkimlqattited
dieelmkdgdknndgridydeflefmkgv

SCOP Domain Coordinates for d1dtla_:

Click to download the PDB-style file with coordinates for d1dtla_.
(The format of our PDB-style files is described here.)

Timeline for d1dtla_: