Lineage for d3anzg1 (3anz G:1-293)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251912Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 2251913Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 2251914Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 2251979Protein automated matches [190904] (3 species)
    not a true protein
  7. 2251980Species Staphylococcus aureus [TaxId:158878] [189747] (5 PDB entries)
  8. 2251987Domain d3anzg1: 3anz G:1-293 [172259]
    Other proteins in same PDB: d3anza2, d3anzb2, d3anzc2, d3anzd2, d3anze2, d3anzf2, d3anzg2, d3anzh2, d3anzi2, d3anzj2, d3anzk2, d3anzl2, d3anzm2, d3anzn2, d3anzo2, d3anzp2, d3anzq2, d3anzr2, d3anzs2, d3anzt2, d3anzu2, d3anzv2, d3anzw2, d3anzx2, d3anzy2, d3anzz2
    automated match to d7ahla_
    complexed with acy, mpd

Details for d3anzg1

PDB Entry: 3anz (more details), 2.3 Å

PDB Description: crystal structure of alpha-hemolysin
PDB Compounds: (G:) alpha-hemolysin

SCOPe Domain Sequences for d3anzg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3anzg1 f.6.1.1 (G:1-293) automated matches {Staphylococcus aureus [TaxId: 158878]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaaenfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOPe Domain Coordinates for d3anzg1:

Click to download the PDB-style file with coordinates for d3anzg1.
(The format of our PDB-style files is described here.)

Timeline for d3anzg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3anzg2
View in 3D
Domains from other chains:
(mouse over for more information)
d3anza1, d3anza2, d3anzb1, d3anzb2, d3anzc1, d3anzc2, d3anzd1, d3anzd2, d3anze1, d3anze2, d3anzf1, d3anzf2, d3anzh1, d3anzh2, d3anzi1, d3anzi2, d3anzj1, d3anzj2, d3anzk1, d3anzk2, d3anzl1, d3anzl2, d3anzm1, d3anzm2, d3anzn1, d3anzn2, d3anzo1, d3anzo2, d3anzp1, d3anzp2, d3anzq1, d3anzq2, d3anzr1, d3anzr2, d3anzs1, d3anzs2, d3anzt1, d3anzt2, d3anzu1, d3anzu2, d3anzv1, d3anzv2, d3anzw1, d3anzw2, d3anzx1, d3anzx2, d3anzy1, d3anzy2, d3anzz1, d3anzz2