SCOPe 2.06: Domain d3anzf1: 3anz F:1-293

Lineage for d3anzf1 (3anz F:1-293)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.6: Leukocidin-like [56958] (1 superfamily)
   subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel

4. Superfamily f.6.1: Leukocidin-like [56959] (3 families)

5. Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
   heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
   automatically mapped to Pfam PF07968

6. Protein automated matches [190904] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [189747] (5 PDB entries)

8. Domain d3anzf1: 3anz F:1-293 [172258]
   Other proteins in same PDB: d3anza2, d3anzb2, d3anzc2, d3anzd2, d3anze2, d3anzf2, d3anzg2, d3anzh2, d3anzi2, d3anzj2, d3anzk2, d3anzl2, d3anzm2, d3anzn2, d3anzo2, d3anzp2, d3anzq2, d3anzr2, d3anzs2, d3anzt2, d3anzu2, d3anzv2, d3anzw2, d3anzx2, d3anzy2, d3anzz2
   automated match to d7ahla_
   complexed with acy, mpd

Details for d3anzf1

PDB Entry: 3anz, 2.3 Å

PDB Description: crystal structure of alpha-hemolysin

PDB Compounds: (F:) alpha-hemolysin

SCOPe Domain Sequences for d3anzf1:

Sequence; same for both SEQRES and ATOM records:

>d3anzf1 f.6.1.1 (F:1-293) automated matches {Staphylococcus aureus [TaxId: 158878]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaaenfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

Timeline for d3anzf1:

• d3anzf1 first appeared in SCOPe 2.01, called d3anzf_
  
• d3anzf1 was called d3anzf_ in SCOPe 2.05
  
• d3anzf1 appears in SCOPe 2.07
  
• d3anzf1 appears in the current release, SCOPe 2.08