Lineage for d3anxb_ (3anx B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 999804Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 999847Protein automated matches [190432] (5 species)
    not a true protein
  7. 999865Species Thermus thermophilus [TaxId:300852] [189902] (1 PDB entry)
  8. 999867Domain d3anxb_: 3anx B: [172252]
    automated match to d1uirb_
    complexed with mta

Details for d3anxb_

PDB Entry: 3anx (more details), 2.5 Å

PDB Description: Crystal structure of triamine/agmatine aminopropyltransferase (SPEE) from thermus thermophilus, complexed with MTA
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d3anxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3anxb_ c.66.1.17 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterde
yiyhetlvhpamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrh
mpewhqgafddpravlviddaraylerteerydvviidltdpvgednparllytvefyrl
vkahlnpggvmgmqagmillthhrvhpvvhrtvreafryvrsyknhipgfflnfgfllas
dafdpaafsegviearirernlalrhltapyleamfvlpkdllealeketmvstdqnpfy
vtpegearqapyk

SCOPe Domain Coordinates for d3anxb_:

Click to download the PDB-style file with coordinates for d3anxb_.
(The format of our PDB-style files is described here.)

Timeline for d3anxb_: