Lineage for d3aksa_ (3aks A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944939Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 944984Protein Xylanase II [49979] (17 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 945050Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries)
  8. 945051Domain d3aksa_: 3aks A: [172222]
    automated match to d1enxa_
    complexed with gol, na

Details for d3aksa_

PDB Entry: 3aks (more details), 0.97 Å

PDB Description: crystal structure of xylanase from trichoderma longibrachiatum
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d3aksa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aksa_ b.29.1.11 (A:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d3aksa_:

Click to download the PDB-style file with coordinates for d3aksa_.
(The format of our PDB-style files is described here.)

Timeline for d3aksa_: