SCOPe 2.01: Domain d3akra_: 3akr A:

Lineage for d3akra_ (3akr A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (17 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries)

8. Domain d3akra_: 3akr A: [172221]
   automated match to d1enxa_
   complexed with gol, na

Details for d3akra_

PDB Entry: 3akr, 1.1 Å

PDB Description: crystal structure of xylanase from trichoderma longibrachiatum

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d3akra_:

Sequence; same for both SEQRES and ATOM records:

>d3akra_ b.29.1.11 (A:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d3akra_:

• d3akra_ is new in SCOPe 2.01-stable
  
• d3akra_ appears in SCOPe 2.02
  
• d3akra_ appears in the current release, SCOPe 2.08