SCOPe 2.04: Domain d3ah8g_: 3ah8 G:

Lineage for d3ah8g_ (3ah8 G:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (20 PDB entries)

8. Domain d3ah8g_: 3ah8 G: [172178]
   Other proteins in same PDB: d3ah8b_
   automated match to d1omwg_
   complexed with gdp

Details for d3ah8g_

PDB Entry: 3ah8, 2.9 Å

PDB Description: structure of heterotrimeric g protein galpha-q beta gamma in complex with an inhibitor ym-254890

PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d3ah8g_:

Sequence; same for both SEQRES and ATOM records:

>d3ah8g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
qarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenp

Timeline for d3ah8g_:

• d3ah8g_ first appeared in SCOPe 2.01
  
• d3ah8g_ appears in SCOPe 2.03
  
• d3ah8g_ appears in SCOPe 2.05
  
• d3ah8g_ appears in the current release, SCOPe 2.08