Lineage for d3ah8g_ (3ah8 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733784Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2733785Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. 2733786Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2733787Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries)
  8. 2733849Domain d3ah8g_: 3ah8 G: [172178]
    Other proteins in same PDB: d3ah8b_
    automated match to d1omwg_
    complexed with gdp

Details for d3ah8g_

PDB Entry: 3ah8 (more details), 2.9 Å

PDB Description: structure of heterotrimeric g protein galpha-q beta gamma in complex with an inhibitor ym-254890
PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d3ah8g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ah8g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
qarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenp

SCOPe Domain Coordinates for d3ah8g_:

Click to download the PDB-style file with coordinates for d3ah8g_.
(The format of our PDB-style files is described here.)

Timeline for d3ah8g_: