Lineage for d3ab5a_ (3ab5 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403183Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1403184Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1403307Protein automated matches [190231] (7 species)
    not a true protein
  7. 1403316Species Cyanidioschyzon merolae [TaxId:45157] [189509] (2 PDB entries)
  8. 1403318Domain d3ab5a_: 3ab5 A: [171912]
    automated match to d4fxca_
    complexed with fes

Details for d3ab5a_

PDB Entry: 3ab5 (more details), 1.18 Å

PDB Description: Crystal structure of the 2Fe 2S Ferredoxin from Cyanidioschyzon merolae
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d3ab5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ab5a_ d.15.4.1 (A:) automated matches {Cyanidioschyzon merolae [TaxId: 45157]}
mykiqlvnqkegidvtiqcagdqyildaaeeqgvdlpyscragacstcagklvkgsvdqs
dqsfldedqiskgfiltcvayptsdcviqthqeealy

SCOPe Domain Coordinates for d3ab5a_:

Click to download the PDB-style file with coordinates for d3ab5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ab5a_: