PDB entry 3ab5

View 3ab5 on RCSB PDB site
Description: Crystal structure of the 2Fe 2S Ferredoxin from Cyanidioschyzon merolae
Class: electron transport
Keywords: Iron sulfur cluster, Chloroplast, Iron, Iron-sulfur, Metal-binding, ELECTRON TRANSPORT
Deposited on 2009-12-01, released 2010-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.177
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Cyanidioschyzon merolae [TaxId:45157]
    Gene: petF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ab5a_
  • Chain 'B':
    Compound: ferredoxin
    Species: Cyanidioschyzon merolae [TaxId:45157]
    Gene: petF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ab5b_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ab5A (A:)
    mykiqlvnqkegidvtiqcagdqyildaaeeqgvdlpyscragacstcagklvkgsvdqs
    dqsfldedqiskgfiltcvayptsdcviqthqeealy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ab5B (B:)
    mykiqlvnqkegidvtiqcagdqyildaaeeqgvdlpyscragacstcagklvkgsvdqs
    dqsfldedqiskgfiltcvayptsdcviqthqeealy