PDB entry 3ab5
View 3ab5 on RCSB PDB site
Description: Crystal structure of the 2Fe 2S Ferredoxin from Cyanidioschyzon merolae
Class: electron transport
Keywords: Iron sulfur cluster, Chloroplast, Iron, Iron-sulfur, Metal-binding, ELECTRON TRANSPORT
Deposited on
2009-12-01, released
2010-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated
2010-11-17, with a file datestamp of
2010-11-12.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.177
AEROSPACI score: 0.81
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ferredoxin
Species: Cyanidioschyzon merolae [TaxId:45157]
Gene: petF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3ab5a_ - Chain 'B':
Compound: ferredoxin
Species: Cyanidioschyzon merolae [TaxId:45157]
Gene: petF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3ab5b_ - Heterogens: FES, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3ab5A (A:)
mykiqlvnqkegidvtiqcagdqyildaaeeqgvdlpyscragacstcagklvkgsvdqs
dqsfldedqiskgfiltcvayptsdcviqthqeealy
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3ab5B (B:)
mykiqlvnqkegidvtiqcagdqyildaaeeqgvdlpyscragacstcagklvkgsvdqs
dqsfldedqiskgfiltcvayptsdcviqthqeealy