SCOPe 2.08: Domain d3ab5a_: 3ab5 A:

Lineage for d3ab5a_ (3ab5 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein automated matches [190231] (14 species)
   not a true protein

7. Species Cyanidioschyzon merolae [TaxId:45157] [189509] (2 PDB entries)

8. Domain d3ab5a_: 3ab5 A: [171912]
   automated match to d4fxca_
   complexed with fes

Details for d3ab5a_

PDB Entry: 3ab5, 1.18 Å

PDB Description: Crystal structure of the 2Fe 2S Ferredoxin from Cyanidioschyzon merolae

PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d3ab5a_:

Sequence; same for both SEQRES and ATOM records:

>d3ab5a_ d.15.4.1 (A:) automated matches {Cyanidioschyzon merolae [TaxId: 45157]}
mykiqlvnqkegidvtiqcagdqyildaaeeqgvdlpyscragacstcagklvkgsvdqs
dqsfldedqiskgfiltcvayptsdcviqthqeealy

Timeline for d3ab5a_:

• d3ab5a_ first appeared in SCOPe 2.01
  
• d3ab5a_ appears in SCOPe 2.07