Lineage for d1e8ab_ (1e8a B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087651Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1087652Protein Calcyclin (S100) [47479] (17 species)
  7. 1087677Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (3 PDB entries)
  8. 1087679Domain d1e8ab_: 1e8a B: [17189]
    complexed with ca

Details for d1e8ab_

PDB Entry: 1e8a (more details), 1.95 Å

PDB Description: the three-dimensional structure of human s100a12
PDB Compounds: (B:) s100a12

SCOPe Domain Sequences for d1e8ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ab_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyht

SCOPe Domain Coordinates for d1e8ab_:

Click to download the PDB-style file with coordinates for d1e8ab_.
(The format of our PDB-style files is described here.)

Timeline for d1e8ab_: