Lineage for d3a6na_ (3a6n A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082815Protein Histone H3 [47122] (6 species)
  7. 1082913Species Human (Homo sapiens) [TaxId:9606] [187038] (5 PDB entries)
  8. 1082922Domain d3a6na_: 3a6n A: [171819]
    automated match to d1kx5a_
    protein/DNA complex; complexed with cl, mn

Details for d3a6na_

PDB Entry: 3a6n (more details), 2.7 Å

PDB Description: The nucleosome containing a testis-specific histone variant, human H3T
PDB Compounds: (A:) Histone H3.1t

SCOPe Domain Sequences for d3a6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6na_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlmreiaqdfktdlrfqssavmalqeace
sylvglfedtnlcvihakrvtimpkdiqlarrirger

SCOPe Domain Coordinates for d3a6na_:

Click to download the PDB-style file with coordinates for d3a6na_.
(The format of our PDB-style files is described here.)

Timeline for d3a6na_: