SCOPe 2.03: Domain d3a6na_: 3a6n A:

Lineage for d3a6na_ (3a6n A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [187038] (10 PDB entries)

8. Domain d3a6na_: 3a6n A: [171819]
   Other proteins in same PDB: d3a6nb_, d3a6nf_
   automated match to d1kx5a_
   protein/DNA complex; complexed with cl, mn

Details for d3a6na_

PDB Entry: 3a6n, 2.7 Å

PDB Description: The nucleosome containing a testis-specific histone variant, human H3T

PDB Compounds: (A:) Histone H3.1t

SCOPe Domain Sequences for d3a6na_:

Sequence; same for both SEQRES and ATOM records:

>d3a6na_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlmreiaqdfktdlrfqssavmalqeace
sylvglfedtnlcvihakrvtimpkdiqlarrirger

Timeline for d3a6na_:

• d3a6na_ first appeared in SCOPe 2.01
  
• d3a6na_ appears in SCOPe 2.02
  
• d3a6na_ appears in SCOPe 2.04
  
• d3a6na_ appears in the current release, SCOPe 2.08