![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein automated matches [190100] (10 species) not a true protein |
![]() | Species Aeropyrum pernix [TaxId:272557] [186846] (8 PDB entries) |
![]() | Domain d3a2vh_: 3a2v H: [171670] automated match to d1x0ra1 complexed with per |
PDB Entry: 3a2v (more details), 1.65 Å
SCOPe Domain Sequences for d3a2vh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a2vh_ c.47.1.10 (H:) automated matches {Aeropyrum pernix [TaxId: 272557]} pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii geglivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakll ye
Timeline for d3a2vh_: