Lineage for d2zwba_ (2zwb A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2531389Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2532723Protein automated matches [190299] (8 species)
    not a true protein
  7. 2532794Species Human (Homo sapiens) [TaxId:9606] [188701] (6 PDB entries)
  8. 2532801Domain d2zwba_: 2zwb A: [171559]
    automated match to d1c7pa_
    complexed with dod

Details for d2zwba_

PDB Entry: 2zwb (more details), 1.8 Å

PDB Description: neutron crystal structure of wild type human lysozyme in d2o
PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d2zwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zwba_ d.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d2zwba_:

Click to download the PDB-style file with coordinates for d2zwba_.
(The format of our PDB-style files is described here.)

Timeline for d2zwba_: