Lineage for d1c7pa_ (1c7p A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2531389Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2531455Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2532460Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries)
    Uniprot P00695
  8. 2532670Domain d1c7pa_: 1c7p A: [36582]
    complexed with na; mutant

Details for d1c7pa_

PDB Entry: 1c7p (more details), 2.4 Å

PDB Description: crystal structure of mutant human lysozyme with four extra residues (eaea) at the n-terminal
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1c7pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7pa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
aeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygif
qinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcq
nrdvrqyvqgcgv

SCOPe Domain Coordinates for d1c7pa_:

Click to download the PDB-style file with coordinates for d1c7pa_.
(The format of our PDB-style files is described here.)

Timeline for d1c7pa_: