| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
| Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
| Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries) Uniprot P00695 |
| Domain d1c7pa_: 1c7p A: [36582] complexed with na; mutant |
PDB Entry: 1c7p (more details), 2.4 Å
SCOPe Domain Sequences for d1c7pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7pa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
aeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygif
qinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcq
nrdvrqyvqgcgv
Timeline for d1c7pa_: