Lineage for d1clb__ (1clb -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152431Family a.39.1.1: Calbindin D9K [47474] (1 protein)
  6. 152432Protein Calbindin D9K [47475] (2 species)
  7. 152433Species Cow (Bos taurus) [TaxId:9913] [47476] (16 PDB entries)
  8. 152446Domain d1clb__: 1clb - [17153]

Details for d1clb__

PDB Entry: 1clb (more details)

PDB Description: determination of the solution structure of apo calbindin d9k by nmr spectroscopy

SCOP Domain Sequences for d1clb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clb__ a.39.1.1 (-) Calbindin D9K {Cow (Bos taurus)}
kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
vsfeefqvlvkkisq

SCOP Domain Coordinates for d1clb__:

Click to download the PDB-style file with coordinates for d1clb__.
(The format of our PDB-style files is described here.)

Timeline for d1clb__: