PDB entry 1clb

View 1clb on RCSB PDB site
Description: determination of the solution structure of apo calbindin d9k by nmr spectroscopy
Deposited on 1995-02-08, released 1995-04-20
The last revision prior to the SCOP 1.61 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1clb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1clb_ (-)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
  vsfeefqvlvkkisq