Lineage for d2zu3a_ (2zu3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2797984Species Human coxsackievirus [TaxId:12072] [188739] (11 PDB entries)
  8. 2797985Domain d2zu3a_: 2zu3 A: [171527]
    automated match to d1l1na_
    complexed with zu3

Details for d2zu3a_

PDB Entry: 2zu3 (more details), 1.75 Å

PDB Description: Complex structure of CVB3 3C protease with TG-0204998
PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d2zu3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zu3a_ b.47.1.4 (A:) automated matches {Human coxsackievirus [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

SCOPe Domain Coordinates for d2zu3a_:

Click to download the PDB-style file with coordinates for d2zu3a_.
(The format of our PDB-style files is described here.)

Timeline for d2zu3a_: