Lineage for d2zsuf_ (2zsu F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129722Family c.66.1.17: Spermidine synthase [69557] (3 protein domains)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2129767Protein automated matches [190432] (5 species)
    not a true protein
  7. 2129778Species Pyrococcus horikoshii [TaxId:53953] [188640] (1 PDB entry)
  8. 2129784Domain d2zsuf_: 2zsu F: [171486]
    automated match to d1mjfa_
    complexed with ag3

Details for d2zsuf_

PDB Entry: 2zsu (more details), 2.2 Å

PDB Description: Crystal structure of spermidine synthase from Pyrococcus horikoshii OT3, P1 form
PDB Compounds: (F:) spermidine synthase

SCOPe Domain Sequences for d2zsuf_:

Sequence, based on SEQRES records: (download)

>d2zsuf_ c.66.1.17 (F:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegeksyh
eplvhpamlahpnprrvliigggdggairevlkheeveevimveidkkvieisakyigid
ggilekmlsdkhekgkliigdgvkfieensgfdviivdstdpvgpaemlfseefyknayr
alndpgiyvtqagsvylftdefltayrkmrkvfdkvyyysfpvigyaspwaflvgvkgsi
dfmkvdaekgkklgleyydpdkhetlfqmpryivqml

Sequence, based on observed residues (ATOM records): (download)

>d2zsuf_ c.66.1.17 (F:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegeksyh
eplvhpamlahpnprrvliigggdggairevlkheeveevimveidkkvieisakyigid
ggilekmlsdkhekgkliigdgvkfieensgfdviivdstdpemlfseefyknayralnd
pgiyvtqagsvylftdefltayrkmrkvfdkvyyysfpvigyaspwaflvgvkgsidfmk
vdaekgkklgleyydpdkhetlfqmpryivqml

SCOPe Domain Coordinates for d2zsuf_:

Click to download the PDB-style file with coordinates for d2zsuf_.
(The format of our PDB-style files is described here.)

Timeline for d2zsuf_: