Lineage for d2zsub_ (2zsu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893343Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2893400Protein automated matches [190432] (6 species)
    not a true protein
  7. 2893411Species Pyrococcus horikoshii [TaxId:53953] [188640] (1 PDB entry)
  8. 2893413Domain d2zsub_: 2zsu B: [171482]
    automated match to d1mjfa_
    complexed with ag3

Details for d2zsub_

PDB Entry: 2zsu (more details), 2.2 Å

PDB Description: Crystal structure of spermidine synthase from Pyrococcus horikoshii OT3, P1 form
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d2zsub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zsub_ c.66.1.17 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
dmefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegeksy
heplvhpamlahpnprrvliigggdggairevlkheeveevimveidkkvieisakyigi
dggilekmlsdkhekgkliigdgvkfieensgfdviivdstdpvgpaemlfseefyknay
ralndpgiyvtqagsvylftdefltayrkmrkvfdkvyyysfpvigyaspwaflvgvkgs
idfmkvdaekgkklgleyydpdkhetlfqmpryivqml

SCOPe Domain Coordinates for d2zsub_:

Click to download the PDB-style file with coordinates for d2zsub_.
(The format of our PDB-style files is described here.)

Timeline for d2zsub_: