SCOPe 2.08: Domain d2zsub_: 2zsu B:

Lineage for d2zsub_ (2zsu B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
   contains additional N-terminal tetramerisation all-beta domain, res. 1-71

6. Protein automated matches [190432] (6 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [188640] (1 PDB entry)

8. Domain d2zsub_: 2zsu B: [171482]
   automated match to d1mjfa_
   complexed with ag3

Details for d2zsub_

PDB Entry: 2zsu, 2.2 Å

PDB Description: Crystal structure of spermidine synthase from Pyrococcus horikoshii OT3, P1 form

PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d2zsub_:

Sequence; same for both SEQRES and ATOM records:

>d2zsub_ c.66.1.17 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
dmefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegeksy
heplvhpamlahpnprrvliigggdggairevlkheeveevimveidkkvieisakyigi
dggilekmlsdkhekgkliigdgvkfieensgfdviivdstdpvgpaemlfseefyknay
ralndpgiyvtqagsvylftdefltayrkmrkvfdkvyyysfpvigyaspwaflvgvkgs
idfmkvdaekgkklgleyydpdkhetlfqmpryivqml

Timeline for d2zsub_:

• d2zsub_ first appeared in SCOPe 2.01
  
• d2zsub_ appears in SCOPe 2.07