SCOP 1.63: Domain d3icb__: 3icb -

Lineage for d3icb__ (3icb -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (9 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.1: Calbindin D9K [47474] (1 protein)
   made of two EF-hands only

6. Protein Calbindin D9K [47475] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47476] (16 PDB entries)

8. Domain d3icb__: 3icb - [17147]
   complexed with ca, so4

Details for d3icb__

PDB Entry: 3icb, 2.3 Å

PDB Description: the refined structure of vitamin d-dependent calcium-binding protein from bovine intestine. molecular details, ion binding, and implications for the structure of other calcium-binding proteins

SCOP Domain Sequences for d3icb__:

Sequence; same for both SEQRES and ATOM records:

>d3icb__ a.39.1.1 (-) Calbindin D9K {Cow (Bos taurus)}
kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdge
vsfeefqvlvkkisq

Timeline for d3icb__:

• d3icb__ first appeared (with stable ids) in SCOP 1.55
  
• d3icb__ appears in SCOP 1.61
  
• d3icb__ appears in SCOP 1.65
  
• d3icb__ appears in the current release, SCOPe 2.08, called d3icba_