| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (9 species) not a true protein |
| Species Achromobacter xylosoxidans [TaxId:85698] [188921] (1 PDB entry) |
| Domain d2zong_: 2zon G: [171386] automated match to d1kx2a_ complexed with cu, hem |
PDB Entry: 2zon (more details), 1.7 Å
SCOPe Domain Sequences for d2zong_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zong_ a.3.1.0 (G:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
qldpageklyrsacvvchasgvanapklgdkqawapflaqgadallatvlkgkgampprg
gtaadeatlraavaymmdaar
Timeline for d2zong_: