Lineage for d2zong_ (2zon G:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 905254Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 905255Protein automated matches [190453] (7 species)
    not a true protein
  7. 905256Species Achromobacter xylosoxidans [TaxId:85698] [188921] (1 PDB entry)
  8. 905257Domain d2zong_: 2zon G: [171386]
    automated match to d1kx2a_
    complexed with cu, hem

Details for d2zong_

PDB Entry: 2zon (more details), 1.7 Å

PDB Description: Crystal structure of electron transfer complex of nitrite reductase with cytochrome c
PDB Compounds: (G:) cytochrome c551

SCOPe Domain Sequences for d2zong_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zong_ a.3.1.0 (G:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
qldpageklyrsacvvchasgvanapklgdkqawapflaqgadallatvlkgkgampprg
gtaadeatlraavaymmdaar

SCOPe Domain Coordinates for d2zong_:

Click to download the PDB-style file with coordinates for d2zong_.
(The format of our PDB-style files is described here.)

Timeline for d2zong_: