Lineage for d2zl2a_ (2zl2 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 980708Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
  6. 980709Protein Clp protease, ClpP subunit [52098] (8 species)
  7. 980740Species Helicobacter pylori [TaxId:210] [188429] (4 PDB entries)
  8. 980755Domain d2zl2a_: 2zl2 A: [171326]
    automated match to d1tyfa_

Details for d2zl2a_

PDB Entry: 2zl2 (more details), 2.5 Å

PDB Description: Crystal structure of H.pylori ClpP in complex with the peptide NVLGFTQ
PDB Compounds: (A:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d2zl2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zl2a_ c.14.1.1 (A:) Clp protease, ClpP subunit {Helicobacter pylori [TaxId: 210]}
diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlqk

SCOPe Domain Coordinates for d2zl2a_:

Click to download the PDB-style file with coordinates for d2zl2a_.
(The format of our PDB-style files is described here.)

Timeline for d2zl2a_: