Lineage for d1tyfa_ (1tyf A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 980708Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
  6. 980709Protein Clp protease, ClpP subunit [52098] (8 species)
  7. 980725Species Escherichia coli [TaxId:562] [52099] (1 PDB entry)
  8. 980726Domain d1tyfa_: 1tyf A: [30885]

Details for d1tyfa_

PDB Entry: 1tyf (more details), 2.3 Å

PDB Description: the structure of clpp at 2.3 angstrom resolution suggests a model for atp-dependent proteolysis
PDB Compounds: (A:) clp peptidase

SCOPe Domain Sequences for d1tyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyfa_ c.14.1.1 (A:) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]}
srgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
hrn

SCOPe Domain Coordinates for d1tyfa_:

Click to download the PDB-style file with coordinates for d1tyfa_.
(The format of our PDB-style files is described here.)

Timeline for d1tyfa_: