SCOP 1.65: Domain d1an2c_: 1an2 C:

Lineage for d1an2c_ (1an2 C:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins)

6. Protein Max protein [47461] (2 species)
   BHLHZ region; contains leucine-zipper motif

7. Species Mouse (Mus musculus) [TaxId:10090] [47463] (1 PDB entry)

8. Domain d1an2c_: 1an2 C: [17131]
   protein/DNA complex

Details for d1an2c_

PDB Entry: 1an2, 2.9 Å

PDB Description: recognition by max of its cognate dna through a dimeric b/hlh/z domain

SCOP Domain Sequences for d1an2c_:

Sequence; same for both SEQRES and ATOM records:

>d1an2c_ a.38.1.1 (C:) Max protein {Mouse (Mus musculus)}
adkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhth
qqdiddlkrqnalleqqvralekars

Timeline for d1an2c_:

• d1an2c_ first appeared (with stable ids) in SCOP 1.55
  
• d1an2c_ appears in SCOP 1.63
  
• d1an2c_ appears in SCOP 1.67
  
• d1an2c_ last appears in SCOP 1.73