Lineage for d1an2c_ (1an2 C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640601Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 640602Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 640603Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 640608Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 640618Species Mouse (Mus musculus) [TaxId:10090] [47463] (1 PDB entry)
  8. Domain d1an2c_: 1an2 C: [17131]
    protein/DNA complex

Details for d1an2c_

PDB Entry: 1an2 (more details), 2.9 Å

PDB Description: recognition by max of its cognate dna through a dimeric b/hlh/z domain

SCOP Domain Sequences for d1an2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an2c_ a.38.1.1 (C:) Max protein {Mouse (Mus musculus) [TaxId: 10090]}
adkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhth
qqdiddlkrqnalleqqvralekars

SCOP Domain Coordinates for d1an2c_:

Click to download the PDB-style file with coordinates for d1an2c_.
(The format of our PDB-style files is described here.)

Timeline for d1an2c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1an2a_