Lineage for d1an2c_ (1an2 C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
  4. Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) (S)
  5. Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (5 proteins)
  6. 3153Protein Max protein [47461] (2 species)
  7. 3157Species Mouse (Mus musculus) [TaxId:10090] [47463] (1 PDB entry)
  8. 3159Domain d1an2c_: 1an2 C: [17131]

Details for d1an2c_

PDB Entry: 1an2 (more details), 2.9 Å

PDB Description: recognition by max of its cognate dna through a dimeric b/hlh/z domain

SCOP Domain Sequences for d1an2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an2c_ a.38.1.1 (C:) Max protein {Mouse (Mus musculus)}
adkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhth
qqdiddlkrqnalleqqvralekars

SCOP Domain Coordinates for d1an2c_:

Click to download the PDB-style file with coordinates for d1an2c_.
(The format of our PDB-style files is described here.)

Timeline for d1an2c_:

3159
d1an2c_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1an2a_