Lineage for d2zcja_ (2zcj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893725Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
    automatically mapped to Pfam PF00145
  6. 2893730Protein DNA methylase HhaI [53367] (2 species)
  7. 2893749Species Haemophilus parahaemolyticus [TaxId:735] [187136] (7 PDB entries)
  8. 2893755Domain d2zcja_: 2zcj A: [171156]
    automated match to d10mha_
    protein/DNA complex; complexed with sah

Details for d2zcja_

PDB Entry: 2zcj (more details), 2.75 Å

PDB Description: ternary structure of the glu119gln m.hhai, c5-cytosine dna methyltransferase, with unmodified dna and adohcy
PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2zcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zcja_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus parahaemolyticus [TaxId: 735]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmqn
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOPe Domain Coordinates for d2zcja_:

Click to download the PDB-style file with coordinates for d2zcja_.
(The format of our PDB-style files is described here.)

Timeline for d2zcja_: