SCOPe 2.01: Domain d1lbgb1: 1lbg B:1-60

Lineage for d1lbgb1 (1lbg B:1-60)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)

7. Species Escherichia coli [TaxId:562] [47442] (11 PDB entries)

8. Domain d1lbgb1: 1lbg B:1-60 [17115]
   Other proteins in same PDB: d1lbga2, d1lbgb2, d1lbgc2, d1lbgd2
   protein/DNA complex

Details for d1lbgb1

PDB Entry: 1lbg, 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only

PDB Compounds: (B:) protein (lactose operon repressor)

SCOPe Domain Sequences for d1lbgb1:

Sequence; same for both SEQRES and ATOM records:

>d1lbgb1 a.35.1.5 (B:1-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

Timeline for d1lbgb1:

• d1lbgb1 first appeared (with stable ids) in SCOP 1.55
  
• d1lbgb1 appears in SCOP 1.75
  
• d1lbgb1 appears in SCOPe 2.02
  
• d1lbgb1 appears in the current release, SCOPe 2.08