![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
![]() | Protein Lac repressor (LacR), N-terminal domain [47441] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47442] (14 PDB entries) |
![]() | Domain d1lbgb1: 1lbg B:1-60 [17115] Other proteins in same PDB: d1lbga2, d1lbgb2, d1lbgc2, d1lbgd2 protein/DNA complex |
PDB Entry: 1lbg (more details), 4.8 Å
SCOPe Domain Sequences for d1lbgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lbgb1 a.35.1.5 (B:1-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
Timeline for d1lbgb1: