Lineage for d1cjgb_ (1cjg B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268313Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1268329Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 1268330Species Escherichia coli [TaxId:562] [47442] (11 PDB entries)
  8. 1268340Domain d1cjgb_: 1cjg B: [17113]
    protein/DNA complex

Details for d1cjgb_

PDB Entry: 1cjg (more details)

PDB Description: nmr structure of lac repressor hp62-dna complex
PDB Compounds: (B:) protein (lac repressor)

SCOPe Domain Sequences for d1cjgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjgb_ a.35.1.5 (B:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
sl

SCOPe Domain Coordinates for d1cjgb_:

Click to download the PDB-style file with coordinates for d1cjgb_.
(The format of our PDB-style files is described here.)

Timeline for d1cjgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cjga_