SCOPe 2.07: Domain d2za0a_: 2za0 A:

Lineage for d2za0a_ (2za0 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold

6. Protein automated matches [190953] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188562] (7 PDB entries)

8. Domain d2za0a_: 2za0 A: [171119]
   automated match to d1qipb_
   complexed with mgi, zn

Details for d2za0a_

PDB Entry: 2za0, 1.7 Å

PDB Description: Crystal structure of mouse glyoxalase I complexed with methyl-gerfelin

PDB Compounds: (A:) Glyoxalase I

SCOPe Domain Sequences for d2za0a_:

Sequence; same for both SEQRES and ATOM records:

>d2za0a_ d.32.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pqpassgltdetafsccsdpdpstkdfllqqtmlrikdpkksldfytrvlgltllqkldf
pamkfslyflayedkndipkdksektawtfsrkatlelthnwgteddetqsyhngnsdpr
gfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkiati

Timeline for d2za0a_:

• d2za0a_ first appeared in SCOPe 2.01
  
• d2za0a_ appears in SCOPe 2.06
  
• d2za0a_ appears in the current release, SCOPe 2.08