Lineage for d1efab1 (1efa B:2-60)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1488831Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1488832Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1489106Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1489122Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 1489123Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)
  8. 1489125Domain d1efab1: 1efa B:2-60 [17107]
    Other proteins in same PDB: d1efaa2, d1efab2, d1efac2
    protein/DNA complex; complexed with npf

Details for d1efab1

PDB Entry: 1efa (more details), 2.6 Å

PDB Description: crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf
PDB Compounds: (B:) lac repressor

SCOPe Domain Sequences for d1efab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efab1 a.35.1.5 (B:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

SCOPe Domain Coordinates for d1efab1:

Click to download the PDB-style file with coordinates for d1efab1.
(The format of our PDB-style files is described here.)

Timeline for d1efab1: