Class a: All alpha proteins [46456] (286 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
Protein Lac repressor (LacR), N-terminal domain [47441] (1 species) |
Species Escherichia coli [TaxId:562] [47442] (14 PDB entries) |
Domain d1efab1: 1efa B:2-60 [17107] Other proteins in same PDB: d1efaa2, d1efab2, d1efac2 protein/DNA complex; complexed with npf |
PDB Entry: 1efa (more details), 2.6 Å
SCOPe Domain Sequences for d1efab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efab1 a.35.1.5 (B:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
Timeline for d1efab1:
View in 3D Domains from other chains: (mouse over for more information) d1efaa1, d1efaa2, d1efac1, d1efac2 |