SCOPe 2.06: Domain d2z6aa_: 2z6a A:

Lineage for d2z6aa_ (2z6a A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
   automatically mapped to Pfam PF00145

6. Protein DNA methylase HhaI [53367] (2 species)

7. Species Haemophilus parahaemolyticus [TaxId:735] [187136] (7 PDB entries)

8. Domain d2z6aa_: 2z6a A: [171067]
   automated match to d10mha_
   protein/DNA complex; complexed with sah

Details for d2z6aa_

PDB Entry: 2z6a, 2.88 Å

PDB Description: s-adenosyl-l-methionine-dependent methyl transfer: observable precatalytic intermediates during dna cytosine methylation

PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2z6aa_:

Sequence; same for both SEQRES and ATOM records:

>d2z6aa_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus parahaemolyticus [TaxId: 735]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpaqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d2z6aa_:

• d2z6aa_ first appeared in SCOPe 2.01
  
• d2z6aa_ appears in SCOPe 2.05
  
• d2z6aa_ appears in SCOPe 2.07
  
• d2z6aa_ appears in the current release, SCOPe 2.08