Lineage for d2z6aa_ (2z6a A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865175Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
    automatically mapped to Pfam PF00145
  6. 1865180Protein DNA methylase HhaI [53367] (2 species)
  7. 1865199Species Haemophilus parahaemolyticus [TaxId:735] [187136] (6 PDB entries)
  8. 1865205Domain d2z6aa_: 2z6a A: [171067]
    automated match to d10mha_
    protein/DNA complex; complexed with sah

Details for d2z6aa_

PDB Entry: 2z6a (more details), 2.88 Å

PDB Description: s-adenosyl-l-methionine-dependent methyl transfer: observable precatalytic intermediates during dna cytosine methylation
PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2z6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z6aa_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus parahaemolyticus [TaxId: 735]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpaqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOPe Domain Coordinates for d2z6aa_:

Click to download the PDB-style file with coordinates for d2z6aa_.
(The format of our PDB-style files is described here.)

Timeline for d2z6aa_: