Lineage for d2z3mb_ (2z3m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968902Family d.108.1.6: LFTR-like [143711] (2 proteins)
    Pfam PF03588; closer relative to the nonribosomal peptidyltransferases (82749); deletion of the N-terminal half of the N-terminal NAT-like domain after the domain duplication/swapping events
  6. 2968903Protein Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) [143712] (1 species)
  7. 2968904Species Escherichia coli [TaxId:562] [143713] (7 PDB entries)
    Uniprot P0A8P1 1-232
  8. 2968915Domain d2z3mb_: 2z3m B: [171040]
    automated match to d2cxaa1
    complexed with 3d1, phe, tar

Details for d2z3mb_

PDB Entry: 2z3m (more details), 2.7 Å

PDB Description: complex structure of LF-transferase and dAF
PDB Compounds: (B:) Leucyl/phenylalanyl-tRNA-protein transferase

SCOPe Domain Sequences for d2z3mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3mb_ d.108.1.6 (B:) Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) {Escherichia coli [TaxId: 562]}
rlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwsp
dpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayh
rlhelghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighg
gklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfsp

SCOPe Domain Coordinates for d2z3mb_:

Click to download the PDB-style file with coordinates for d2z3mb_.
(The format of our PDB-style files is described here.)

Timeline for d2z3mb_: